WhoIs instantcheckmate.com aka instantbgcheck.com

Potential Predators
From what we’ve observed it appears that instantcheckmate.com may be associated with complaintsboard.com

August 11, 2012

Dear InstantCheckMate:

Thank you for your inquiry. Instant Checkmate respects each individual’s privacy and would be more than happy to accommodate your request.

Instant Checkmate.com compiles reports from millions of public records including information provided by state and local governments. All of the information contained in our reports is part of what is referred to as the “public record.”

This letter is to inform you that the following information was removed from our website on August 11, 2012:

Brandon Thomas bambam22386@gmail.com
support@instantcheckmate.com
http://instantbgcheck.com/contactus.html

unsolicited email from instant-checkmate

Consumer complaints allege false and inaccurate information is being provided when background checks are initiated. Complainants claim when contacting the company to correct or remove the inaccurate information, they are told to opt-out via the website. Other complainants claim that membership is paid and they receive either inaccurate information or no information.


Address lookup
canonical name instantcheckmate.com

aliases
addresses 108.166.34.81
Domain Whois record

Queried whois.internic.net with “dom instantcheckmate.com

Domain Name: INSTANTCHECKMATE.COM
Registrar: GODADDY.COM, LLC
Whois Server: whois.godaddy.com
Referral URL: http://registrar.godaddy.com
Name Server: AMY.NS.CLOUDFLARE.COM
Name Server: JEFF.NS.CLOUDFLARE.COM
Status: clientDeleteProhibited
Status: clientRenewProhibited
Status: clientTransferProhibited
Status: clientUpdateProhibited
Updated Date: 22-mar-2012
Creation Date: 17-jun-2010
Expiration Date: 17-jun-2020

Last update of whois database: Wed, 15 Aug 2012 01:58:19 UTC
Queried whois.godaddy.com with “instantcheckmate.com

Registrant:
Instant Check Mate LLC
PO Box 3141
Incline Village, Nevada 89450
United States

Registered through: GoDaddy.com, LLC (http://www.godaddy.com)
Domain Name: INSTANTCHECKMATE.COM
Created on: 17-Jun-10
Expires on: 17-Jun-20
Last Updated on: 22-Mar-12

Administrative Contact:
Kibak, Kristian kris@instantcheckmate.com
Instant Check Mate LLC
PO Box 3141
Incline Village, Nevada 89450
United States
+1.8664905980 Fax — +1.866-490-5980

Technical Contact:
Kibak, Kristian kris@instantcheckmate.com
Instant Check Mate LLC
PO Box 3141
Incline Village, Nevada 89450
United States
+1.8664905980 Fax — +1.8664905980

Domain servers in listed order:
AMY.NS.CLOUDFLARE.COM
JEFF.NS.CLOUDFLARE.COM

Network Whois record
Queried whois.arin.net with “n ! NET-108-166-34-80-1″…

NetRange: 108.166.34.80 – 108.166.34.87
CIDR: 108.166.34.80/29
OriginAS:
NetName: RACKS-8-1330455854395434
NetHandle: NET-108-166-34-80-1
Parent: NET-108-166-0-0-1
NetType: Reassigned
RegDate: 2012-02-28
Updated: 2012-02-28
Ref: http://whois.arin.net/rest/net/NET-108-166-34-80-1

CustName: Instant Check Mate LLC
Address: 895 Grand Ave.
City: San Diego
StateProv: CA
PostalCode: 92109
Country: US
RegDate: 2012-02-28
Updated: 2012-02-28
Ref: http://whois.arin.net/rest/customer/C02939455

OrgAbuseHandle: ABUSE45-ARIN
OrgAbuseName: Abuse Desk
OrgAbusePhone: +1-210-892-4000
OrgAbuseEmail: abuse@rackspace.com
OrgAbuseRef: http://whois.arin.net/rest/poc/ABUSE45-ARIN

OrgTechHandle: IPADM17-ARIN
OrgTechName: IPADMIN
OrgTechPhone: +1-210-892-4000
OrgTechEmail: hostmaster@rackspace.com
OrgTechRef: http://whois.arin.net/rest/poc/IPADM17-ARIN

DNS records

DNS query for 81.34.166.108.in-addr.arpa returned an error from the server: NameError
name class type data time to live
instantcheckmate.com IN SOA
server: amy.ns.cloudflare.com
email: dns@cloudflare.com
serial: 2012080909
refresh: 10000
retry: 2400
expire: 604800
minimum ttl: 3600
86400s (1.00:00:00)
instantcheckmate.com IN MX
preference: 15
exchange: aspmx3.googlemail.com
300s (00:05:00)
instantcheckmate.com IN MX
preference: 15
exchange: aspmx2.googlemail.com
300s (00:05:00)
instantcheckmate.com IN TXT v=spf1 ip4:99.59.112.175 ip4:50.28.15.219 ip4:50.28.15.217 ip4:50.28.15.77 ip4:50.28.15.75 ip4:50.28.15.73 include:_spf.google.com ~all 300s (00:05:00)
instantcheckmate.com IN A 108.166.34.81 300s (00:05:00)
instantcheckmate.com IN MX
preference: 5
exchange: alt1.aspmx.l.google.com
300s (00:05:00)
instantcheckmate.com IN MX
preference: 5
exchange: alt2.aspmx.l.google.com
300s (00:05:00)
instantcheckmate.com IN MX
preference: 5
exchange: aspmx.l.google.com
300s (00:05:00)
instantcheckmate.com IN NS amy.ns.cloudflare.com 86400s (1.00:00:00)
instantcheckmate.com IN NS jeff.ns.cloudflare.com 86400s (1.00:00:00)

— end —


Address lookup
canonical name instantbgcheck.com

aliases
addresses 67.228.162.32
Domain Whois record

Queried whois.internic.net with “dom instantbgcheck.com”…

Domain Name: INSTANTBGCHECK.COM
Registrar: ENOM, INC.
Whois Server: whois.enom.com
Referral URL: http://www.enom.com
Name Server: DNS1.REGISTRAR-SERVERS.COM
Name Server: DNS2.REGISTRAR-SERVERS.COM
Name Server: DNS3.REGISTRAR-SERVERS.COM
Name Server: DNS4.REGISTRAR-SERVERS.COM
Name Server: DNS5.REGISTRAR-SERVERS.COM
Status: clientTransferProhibited
Updated Date: 25-jan-2012
Creation Date: 25-jan-2012
Expiration Date: 25-jan-2013

Last update of whois database: Wed, 15 Aug 2012 02:35:10 UTC <<<
Queried whois.enom.com with “instantbgcheck.com”…

Domain name: instantbgcheck.com

Registrant Contact:
WhoisGuard
WhoisGuard Protected ()

Fax:
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US

Administrative Contact:
WhoisGuard
WhoisGuard Protected (f35012bc3fa1487b80479839bf129366.protect@whoisguard.com)
+1.6613102107
Fax: +1.6613102107
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US

Technical Contact:
WhoisGuard
WhoisGuard Protected (f35012bc3fa1487b80479839bf129366.protect@whoisguard.com)
+1.6613102107
Fax: +1.6613102107
11400 W. Olympic Blvd. Suite 200
Los Angeles, CA 90064
US

Status: Locked

Name Servers:
dns1.registrar-servers.com
dns2.registrar-servers.com
dns3.registrar-servers.com
dns4.registrar-servers.com
dns5.registrar-servers.com

Creation date: 25 Jan 2012 20:06:00
Expiration date: 25 Jan 2013 12:06:00

Network Whois record

Queried rwhois.softlayer.com with “67.228.162.32”…

%rwhois V-1.5:003fff:00 rwhois.softlayer.com (by Network Solutions, Inc. V-1.5.9.5)
network:Class-Name:network
network:ID:NETBLK-SOFTLAYER.67.228.160.0/19
network:Auth-Area:67.228.160.0/19
network:Network-Name:SOFTLAYER-67.228.160.0
network:IP-Network:67.228.162.32/30
network:IP-Network-Block:67.228.162.32-67.228.162.35
network:Organization;I:NC Global
network:Street-Address:375 Harvard St. #11
network:City:Cambridge
network:State:MA
network:Postal-Code:02138
network:Country-Code:US
network:Tech-Contact;I:sysadmins@softlayer.com
network:Abuse-Contact;I:abuse@dedicakes.com
network:Admin-Contact;I:IPADM258-ARIN
network:Created:20080607
network:Updated:20101119
network:Updated-By:ipadmin@softlayer.com

referral rwhois://root.rwhois.net:4321/auth-area=.
ok
Queried whois.arin.net with “n 67.228.162.32″…

NetRange: 67.228.0.0 – 67.228.255.255
CIDR: 67.228.0.0/16
OriginAS: AS36351
NetName: SOFTLAYER-4-5
NetHandle: NET-67-228-0-0-1
Parent: NET-67-0-0-0-0
NetType: Direct Allocation
Comment: The IP addresses in this block are the envy of all of their IP address neighbors… The SoftLayer network is where all IPs want to be.
RegDate: 2007-11-07
Updated: 2012-03-28
Ref: http://whois.arin.net/rest/net/NET-67-228-0-0-1

OrgName: SoftLayer Technologies Inc.
OrgId: SOFTL
Address: 4849 Alpha Rd.
City: Dallas
StateProv: TX
PostalCode: 75244
Country: US
RegDate: 2005-10-26
Updated: 2012-01-27
Ref: http://whois.arin.net/rest/org/SOFTL

ReferralServer: rwhois://rwhois.softlayer.com:4321

OrgAbuseHandle: ABUSE1025-ARIN
OrgAbuseName: Abuse
OrgAbusePhone: +1-214-442-0605
OrgAbuseEmail: abuse@softlayer.com
OrgAbuseRef: http://whois.arin.net/rest/poc/ABUSE1025-ARIN

OrgTechHandle: IPADM258-ARIN
OrgTechName: IP Admin
OrgTechPhone: +1-214-442-0600
OrgTechEmail: ipadmin@softlayer.com
OrgTechRef: http://whois.arin.net/rest/poc/IPADM258-ARIN

RNOCHandle: IPADM258-ARIN
RNOCName: IP Admin
RNOCPhone: +1-214-442-0600
RNOCEmail: ipadmin@softlayer.com
RNOCRef: http://whois.arin.net/rest/poc/IPADM258-ARIN

RTechHandle: IPADM258-ARIN
RTechName: IP Admin
RTechPhone: +1-214-442-0600
RTechEmail: ipadmin@softlayer.com
RTechRef: http://whois.arin.net/rest/poc/IPADM258-ARIN

RAbuseHandle: ABUSE1025-ARIN
RAbuseName: Abuse
RAbusePhone: +1-214-442-0605
RAbuseEmail: abuse@softlayer.com
RAbuseRef: http://whois.arin.net/rest/poc/ABUSE1025-ARIN

DNS records
name class type data time to live
instantbgcheck.com IN NS dns1.registrar-servers.com 1800s (00:30:00)
instantbgcheck.com IN SOA
server: dns1.registrar-servers.com
email: hostmaster@registrar-servers.com
serial: 2012020300
refresh: 10001
retry: 1801
expire: 604801
minimum ttl: 3601
3601s (01:00:01)
instantbgcheck.com IN NS dns5.registrar-servers.com 1800s (00:30:00)
instantbgcheck.com IN MX
preference: 10
exchange: eforward2.registrar-servers.com
1800s (00:30:00)
instantbgcheck.com IN NS dns3.registrar-servers.com 1800s (00:30:00)
instantbgcheck.com IN NS dns2.registrar-servers.com 1800s (00:30:00)
instantbgcheck.com IN MX
preference: 10
exchange: eforward3.registrar-servers.com
1800s (00:30:00)
instantbgcheck.com IN MX
preference: 15
exchange: eforward4.registrar-servers.com
1800s (00:30:00)
instantbgcheck.com IN MX
preference: 10
exchange: eforward1.registrar-servers.com
1800s (00:30:00)
instantbgcheck.com IN NS dns4.registrar-servers.com 1800s (00:30:00)
instantbgcheck.com IN A 67.228.162.32 1800s (00:30:00)
instantbgcheck.com IN MX
preference: 20
exchange: eforward5.registrar-servers.com
1800s (00:30:00)
32.162.228.67.in-addr.arpa IN PTR 67.228.162.32-static.reverse.softlayer.com 3600s (01:00:00)
162.228.67.in-addr.arpa IN SOA
server: ns1.arpa.global-datacenter.com
email: root@softlayer.com
serial: 2012072901
refresh: 10800
retry: 3600
expire: 604800
minimum ttl: 3600
3600s (01:00:00)
162.228.67.in-addr.arpa IN NS ns2.arpa.global-datacenter.com 3600s (01:00:00)
162.228.67.in-addr.arpa IN NS ns1.arpa.global-datacenter.com 3600s (01:00:00)

— end —


    1. montelwilliamsloan.us
    2. paydayloanpersonalloan.us
    3. B2sit.com
    4. montelwilliamsloan.us
    5. paydayloanpersonalloan.us
    6. checkcreditscore888.us
    7. searscareers.us
    8. pinellascountypublicrecords.us
    9. corporatebackgroundchecks.us
    10. collincountycourtrecords.us
    11. hcsoarrestinquiry.us
    12. cookcountyjailinmatesearch.us
    13. miamidadeinmatesearch.us
    14. miamidadecriminalrecords.us
    15. bestloan1500now.us
    16. freeonlinecriminalbackgroundrecordcheck.us
    17. criminalrecordssearch.in
    18. jeffrey.farina.countypublicrecords.us
    19. instantcheckmate.com
    20. instantbgcheck.com
    21. PENISSTRETCHES.ORG
    22. ondemandcourtrecords.us
    23. Newpaydayloans247.com
    24. jobsincharlottenc.us
    25. ctinmatesearch.us
    26. cheaprollerblades1.info
    27. bestmattressforsidesleepers.info
    28. checkyourcreditscore.us
    29. CANNINGJARSFORSALE.INFO
    30. http://www.cashquickloans.info
    31. Bestspincastreel.info
    32. Bestlongboardtrucks.info
    33. winerackscheaps.info
    34. goolike.com
    35. Fast4diet.com
    36. blackfridaycybermondaysaleprices.info
    37. blackfridaycamcorders1.us
    38. jobservicend.us
    39. nco.info
    40. puppyobediencetraining101.com
    41. 11370.info
    42. truthaboutsixpackabsreviewed.com
    43. parisgraves.com
    44. caulking.biz
    45. puppyobediencetraining101.com
    46. searscareers.us
    47. parisgraves.com
    48. caulking.biz
    49. truthaboutsixpackabsreviewed.com
  1. usdloan.com
  2. discountlongboards1.com
  3. dcr-sx63reviews.info
  4. demoskisforsale.info
  5. directorschairscheap.info
  6. discountchefpants.info
  7. discountcompressionstocking.info
  8. discountdraperyhardware.info
  9. discountellipticalmachine1.info
  10. discountpoolcleaners.info
  11. discountrubbermulch.info
  12. discountsnowblowers.info
  13. discountwakeboards.info
    electricimpactwrenchrevie…
  14. electronicstethoscoperevi…
  15. eyelashgrowthproductsrevi…
  16. heavyputterreview.info
  17. indoorwaterfallsforsale…
  18. johndeeresnowblowersrevie…
  19. kneeboardsforsale.info
  20. midsizesuvcomparison.info
  21. minilathereviews1.info
  22. moletrapsforsale.info
  23. morelmushroomsforsale…
  24. neilmedsinusrinsereview…
  25. nonhybridseedsforsale…
  26. nosaltwatersoftenerreview…
  27. novaformmattressreview…
  28. ocarinasforsales.info
  29. otoscopesforsale.info
  30. outdoorwoodfurnacereviews…
  31. ovulationpredictorkitsrev…
  32. paintballbunkersforsale…
  33. persimmontreesforsale…
  34. petzlifeoralcarereviews…
  35. picoprojectorcomparison…
  36. pigroastersforsale.info
  37. pinnailerreviews.info
  38. pocketprojectorcomparison…
  39. pomegranatetreesforsale…
  40. portabledancefloorsforsal…
  41. portableoxygenconcentrato…
  42. portableoxygenconcentrato…
  43. portapottiesforsale.info
  44. pressurecannerreviews…
  45. pressurecannersforsale…
  46. quartzinfraredheaterrevie…
  47. rectangletrampolinesforsa…
  48. redwigglersforsale.info
  49. redwigglerwormsforsale…
  50. remington870wingmasterpri…
  51. retractableawningsreviews…
  52. rimsandtirespackagedeals…
  53. rototillerreviews.info
  54. roundtableclothscheap…
  55. rubbermulchprices.info
  56. saltlesswatersoftenerrevi…
  57. skigogglereviews.info
  58. slidingcompoundmitersaws…
  59. solarpoweredatticfansrevi…
  60. syntheticturfprices.info
  61. tatamimatsforsale.info
  62. thermalcurtainscheap.info
  63. tirechangersforsale.info
  64. toasterovenreviewsratings…
  65. treelesssaddlesforsale…
  66. trombonemouthpiececompari…
  67. tubularskylightsreviews…
  68. ultrasonicjewelrycleanerr…
  69. usboscilloscopereview…
  70. ushankahatsforsale.info
  71. vinylcuttersforsale.info
  72. violinsforsalecheaps.info
  73. vocalboothforsale.info
  74. dehumidifierrepair.info
  75. dehumidifierreviewsrating…
  76. dehydratorreviews0.info
  77. dehydratorsforsales.info
  78. dehydratorsreviews1.info
  79. directhardmoneylenders.us
  80. directlenderpaydayloans1…
  81. directlenderpaydayloan.us
  82. directlendersforpaydayloa…
  83. discountbaseballbatsz…
  84. discountdumbbells.info
  85. discountkitchenfaucetz…
  86. discountkitchensinks.info
  87. discountpillarcandles…
  88. discountpoolchemicals…
  89. discountpoolfiltersk.info
  90. discountsnowblowers8.info
  91. discountsoftballequipment…
  92. discountstorageshedsz…
  93. discounttriathlonwetsuits…
  94. discounttrucktoolboxes…
  95. discountwetsuit.info
  96. discountwindowblinds0…
  97. discountwinerackss.info
  98. discountwoodblinds1.info
  99. discountwroughtironpatiof…
  100. dockboxesforsale.info
  101. dripcoffeemakerreviewss…
  102. dumbbellscheap.info
  103. dumbbellsetsforsaled.info
  104. gardenbenchesonsale.info
  105. grindandbrewcoffeemakerre…
  106. magnumpaydayloans.us
  107. meatgrinderreviews0.info
  108. migwelderforsaled.info
  109. migwelderreviews.info
  110. migweldersale.info
  111. migweldersforsalez.info
  112. militarypaydays2011.us
  113. millerweldersforsale.info
  114. missouripaydayloansx.us
  115. mitersawreviewd.info
  116. mitersawsforsalez.info
  117. mitersawstandreviewsk…
  118. mitresawreviews7.info
  119. moonbounceforsales.info
  120. mosquitofoggerreviewss…
  121. mosquitotrapreviews3.info
  122. naturalsoapswholesale…
  123. naturalsoapwholesale.info
  124. nodirectdepositpaydayloan.info
  125. nofaxcashadvances.us
  126. nofaxingpaydayloansx.us
  127. nofaxpaydayloansx.us
  128. notelecheckpaydayloans1.info
  129. noteletrackloansz.us
  130. noteletrackpaydayloansus.info
  131. noteletrackpaydayloanus.info
  132. obdiiscannerreviews7.info
  133. oilburnerswholesale.info
  134. oilcandleswholesale.info
  135. onlinepaydayloansdirectle.info
  136. paintsprayerreviewsz.info
  137. paintsprayersreviewsq.info
  138. paninigrillreviewss.info
  139. paninimakerreviews.info
  140. paperlesspaydayloans1.us
  141. parkbenchesforsaleq.info
  142. paydaydirectlenders.us
  143. paydayloandirectlender1.info
  144. paydayloandirectlenderson.info
  145. paydayloannoteletrack.us
  146. paydayloansaustintx.us
  147. paydayloanscharlottenc.us
  148. paydayloanscoloradospring…
  149. paydayloansdallastx.us
  150. paydayloansdirectlenders…
  151. paydayloansdirectlendersu…
  152. paydayloanshawaii.us
  153. paydayloansnodirectdeposit
  154. paydayloansnoteletrack1…
  155. paydayloansonlinedirectle…
  156. paydayloansportlandoregon…
  157. paydayloanstoresz.us
  158. pillarcandlescheap.info
  159. pillarcandleswholesale…
  160. plasmacutterforsale.info
  161. plasmacutterreviewsx.info
  162. plasmacuttersale.info
  163. plasmacuttersforsales…
  164. platejoinerreviews.info
  165. podcoffeemakerreviews…
  166. poolcleanersautomaticrevi…
  167. poolcleanerscomparison…
  168. portablebasketballhooprev…
  169. portablebasketballhoopsfo…
  170. portablebasketballsystemr…
  171. portableoxygenconcentrato…
  172. portableultrasoundmachine…
  173. pressurecookersforsales…
  174. pushmowerreviewsz.info
  175. reciprocatingsawreviewsz…
  176. reellawnmowersforsale…
  177. reelmowersforsaleq.info
  178. refundanticipationloans1…
  179. rehabhardmoneylenders.us
  180. ridingmowersforsalez.info
  181. saltchlorinegeneratorrevi.info
  182. samedayloansnocreditcheck.info
  183. selfpropelledlawnmowerrev.info
  184. shavedsoftballbatsforsale.info
  185. shortterminstallmentloans.info
  186. singlecupcoffeemakerrevie.info
  187. singleservecoffeemakerrev.info
  188. singleservecoffeemakersre.info
  189. slidingcompoundmitersawre.info
  190. slowpitchsoftballbatrevie.info
  191. slowpitchsoftballbatsrevi.info
  192. snowbladesforsale.info
  193. snowblowercomparison.info
  194. snowblowerrepairs.info
  195. snowblowerreview.info
  196. snowblowerreviews1.info
  197. snowblowerscheap.info
  198. snowblowersforsalez.info
  199. snowblowersonsales.info
  200. snowblowersreview.info
  201. snowblowersreviewsx.info
  202. snowblowerssale.info
  203. snowconemachinesforsales.info
  204. snowplowreviewsz.info
  205. snowplowsforsales.info
  206. snowplowtruckforsale.info
  207. snowplowtrucksforsale.info
  208. snowremovalequipmentforsa.info
  209. snowthrowerreviewsx.info
  210. snowthrowersale0.info
  211. snowthrowersforsalez.info
  212. soapmakingsupplieswholesa.info
  213. soapmoldsforsale.info
  214. soapmoldswholesale.info
  215. soapnutsreviews.info
  216. soapsupplieswholesale.info
  217. softballbatreviews2011.info
  218. softballbatreviewsx.info
  219. softballbatsforsalez.info
  220. softballbatsreviews.info
  221. soymilkmakerreviewss.info
  222. spotweldersforsale.info
  223. stringtrimmerreview.info
  224. stringtrimmerreviewsx.info
  225. studentloansnocosigners.info
  226. studentloanswithoutacosig.info
  227. studentloanswithoutcosign.info
  228. superautomaticespressomac.info
  229. tablesawsreviewsq.info
  230. thermalcoffeemakerreviews.info
  231. tigwelderforsale.info
  232. tigweldersforsalez.info
  233. titleloansinmaryland.us
  234. tractorsnowblowersforsale.info
  235. triathlonwetsuitsale8.info
  236. twostagesnowblowerreviews.info
  237. ultrasonicpestcontrolrevi.info
  238. undersinkwaterfilterrevie.info
  239. unsecuredpersonallineofcr.info
  240. votiveholderswholesale.info
  241. potentialpredators.com
Advertisements

12 thoughts on “WhoIs instantcheckmate.com aka instantbgcheck.com

  1. THEReporter says:

    instant checkmate…criminal background agency…the information is not accurate…everyone you check out earns the same salary…it shows individuals with a criminal background living at addresses that they don’t reside at…if you are thinking of using this company you better read their rules beforehand…the promo is for 5 days for a $1.00…when you click on the promo and don’t call to cancel before the 5 day promo ends you are billed at $24.63 a month every month until you call and cancel it…

    if you complain they have an answer super fast, they obviously get complaints all the time, real snotty person, what a job to have, dealing with people that feel they got ripped off. They don’t explain that you are going to get billed every month unless you read their rules on their website, I was amazed that my visa statement showed a charge of $24.63 instead of the $1.00 I was expecting and this continues every month unless you call them to cancel…this is a rip off and the information you get on somebody cannot be guaranteed…don’t use them…

  2. THEReporter says:

    On 19-March-2012, I received spam email promoting instantcheckmate.com that was transmitted via IP 94.131.80.2 in the Ukraine.

    The URLs in the email link to click.soundsbroad.net (IP 64.112.126.154), which I assume acts as a spam stooge that redirects web traffic to your site.

    IP 94.131.80.2 and IP 64.112.126.154 seem to be blacklisted (SBL) at the moment.

    The email contains the following contact information:

    Instant Checkmate LLC.
    3995 W. Quail Ave, Ste. B.
    Las Vegas, NV 89118 ”

    I have considered your concerns, but I have decided not to change my rating, due to some problems with your site.

    1. Your IP address is blacklisted by blackholes.five-ten-sg.com. Although this is not a huge deal and they have been associated with high false positive rates, it is best you get that cleared up, as it may pose problems in the future.

    2. Your website supposedly steals credit card numbers and puts up incorrect information. A complaint about this was posted here: http://www.ripoffreport.com/private-investigators/

    You also have a many other complaints on RipoffReport, as well (see http://www.ripoffreport.com/Search/Instant-Checkma

    3. Despite what you have claimed, you still send spam. I have over 24 spam messages in my inbox, most of them from your site. One of the messages is here:

    SOURCE:http://www.mywot.com/en/forum/21542-instantcheckmate-com

  3. THEReporter says:

    Registrant ID:CR72646384
    Registrant Name:Aussawin Kampoosan
    Registrant Organization:
    Registrant City:Khon Kaen
    Registrant State/Province:SAKON NAKHON
    Registrant Postal Code:40000
    Registrant Country:TH
    Registrant Phone:+66.846032471
    Registrant Email:winning.noom@gmail.com

    Admin ID:CR72646386
    Admin Name:Aussawin Kampoosan
    Admin Organization:
    Admin City:Khon Kaen
    Admin State/Province:SAKON NAKHON
    Admin Postal Code:40000
    Admin Country:TH
    Admin Phone:+66.846032471
    Admin Email:winning.noom@gmail.com

    Billing ID:CR72646387
    Billing Name:Aussawin Kampoosan
    Billing Organization:
    Billing City:Khon Kaen
    Billing State/Province:SAKON NAKHON
    Billing Postal Code:40000
    Billing Country:TH
    Billing Phone:+66.846032471
    Billing Email:winning.noom@gmail.com

    Tech ID:CR72646385
    Tech Name:Aussawin Kampoosan
    Tech Organization:
    Tech City:Khon Kaen
    Tech State/Province:SAKON NAKHON
    Tech Postal Code:40000
    Tech Country:TH
    Tech Phone:+66.846032471
    Tech Email:winning.noom@gmail.com

    Name Server:NS15.DOMAINCONTROL.COM
    Name Server:NS16.DOMAINCONTROL.COM

  4. THEReporter says:

    Visit AboutUs.org for more information about goolike.com
    AboutUs: goolike.com

    Domain Name: goolike.com
    Registrar: Name.com LLC

    Name Servers:
    ns1.goolike.com
    ns2.goolike.com

    REGISTRANT CONTACT INFO
    Aussawin
    Aussawin Kampoosan

    Khon Kaen

    40000
    TH
    Phone: +66.46032471
    Email Address: winning.noom@gmail.com

    ADMINISTRATIVE CONTACT INFO
    Aussawin
    Aussawin Kampoosan

    Khon Kaen

    40000
    TH
    Phone: +66.46032471
    Email Address: winning.noom@gmail.com

    TECHNICAL CONTACT INFO
    Aussawin
    Aussawin Kampoosan

    Khon Kaen

    40000
    TH
    Phone: +66.46032471
    Email Address: winning.noom@gmail.com

    BILLING CONTACT INFO
    Aussawin
    Aussawin Kampoosan

    Khon Kaen

    40000
    TH
    Phone: +66.46032471
    Email Address: winning.noom@gmail.com

    Timestamp: 1278132872.9042

  5. THEReporter says:

    Address lookup
    canonical name ns1.bodis.com
    aliases
    addresses 199.59.241.220
    Domain Whois record

    Queried whois.internic.net with “dom bodis.com

    Domain Name: BODIS.COM
    Registrar: INTERNET.BS CORP.
    Whois Server: whois.internet.bs
    Referral URL: http://www.internet.bs
    Name Server: NS1.BODIS.COM
    Name Server: NS2.BODIS.COM
    Status: clientTransferProhibited
    Updated Date: 14-aug-2012
    Creation Date: 13-dec-2005
    Expiration Date: 13-dec-2017

    Last update of whois database: Wed, 15 Aug 2012 04:03:20 UTC
    Queried whois.internet.bs with bodis.com

    Query error: TimedOut
    Network Whois record

    Queried whois.arin.net with "n 199.59.241.220"…

    NetRange: 199.59.240.0 – 199.59.243.255
    CIDR: 199.59.240.0/22
    OriginAS: AS53665
    NetName: BODIS-COM
    NetHandle: NET-199-59-240-0-1
    Parent: NET-199-0-0-0-0
    NetType: Direct Allocation
    RegDate: 2010-12-09
    Updated: 2012-03-02
    Ref: http://whois.arin.net/rest/net/NET-199-59-240-0-1

    OrgName: Bodis, LLC
    OrgId: BODIS-1
    Address: Suite 502A-18825, Block A
    Address: Shekou Technology Building 2
    City: Shenzhen
    StateProv: Nanshan District
    PostalCode: 518067
    Country: CN
    RegDate: 2010-09-27
    Updated: 2011-06-12
    Ref: http://whois.arin.net/rest/org/BODIS-1

    OrgNOCHandle: BODIS3-ARIN
    OrgNOCName: Bodis Administrator
    OrgNOCPhone: +86.76983060091
    OrgNOCEmail: dnsadmin@bodis.com
    OrgNOCRef: http://whois.arin.net/rest/poc/BODIS3-ARIN

    OrgAbuseHandle: BODIS2-ARIN
    OrgAbuseName: Bodis Abuse
    OrgAbusePhone: +86.76983060091
    OrgAbuseEmail: abuse@bodis.com
    OrgAbuseRef: http://whois.arin.net/rest/poc/BODIS2-ARIN

    OrgTechHandle: BODIS3-ARIN
    OrgTechName: Bodis Administrator
    OrgTechPhone: +86.76983060091
    OrgTechEmail: dnsadmin@bodis.com
    OrgTechRef: http://whois.arin.net/rest/poc/BODIS3-ARIN

    RTechHandle: BODIS3-ARIN
    RTechName: Bodis Administrator
    RTechPhone: +86.76983060091
    RTechEmail: dnsadmin@bodis.com
    RTechRef: http://whois.arin.net/rest/poc/BODIS3-ARIN

    RAbuseHandle: BODIS2-ARIN
    RAbuseName: Bodis Abuse
    RAbusePhone: +86.76983060091
    RAbuseEmail: abuse@bodis.com
    RAbuseRef: http://whois.arin.net/rest/poc/BODIS2-ARIN

    RNOCHandle: BODIS3-ARIN
    RNOCName: Bodis Administrator
    RNOCPhone: +86.76983060091
    RNOCEmail: dnsadmin@bodis.com
    RNOCRef: http://whois.arin.net/rest/poc/BODIS3-ARIN

  6. THEReporter says:

    Company: Aussawin Kampoosan Registrant Organization:
    Address: – Khon Kaen SAKON NAKHON 40000 TH
    Phone: +66.846032471
    8 most popular domains of this owner:

    frontloaderwasherreviews.info – frontloaderwasherreviews.info

    Daily visitors: –
    Keywords: front loader washer reviews, review of front loader washer, bosch was20160uc
    halfpipesforsale.info – halfpipesforsale.info

    Daily visitors: –
    Keywords: halfpipes for sale, cheap halfpipes, halfpipes for sale cheap, cheap halfpipes for sale
    stovetoppopcornpoppers.info – stovetoppopcornpoppers.info

    Daily visitors: –
    Keywords: theater, popcorn, Valley, handle, induction, stainless, wabash, Popper, detachable, professional
    cheaprollerblades1.info – Cheap Rollerblades – Review, Compare Price & Buy

    Daily visitors: –
    Keywords: cheap rollerblades, rollerblade reviews, buy rollerblades
    cheapkegerators.info – cheapkegerators.info

    Daily visitors: –
    Keywords: cheap kegerators, kegerators for sale, edge star dispenser tap conversion kit
    bestpillowforstomachsleepers.info – bestpillowforstomachsleepers.info

    Daily visitors: –
    Keywords: best pillow for stomach sleepers, right pillow for a stomach sleeper, best ergonomic mattress
    bestrunningshoesforshinsplints.info – bestrunningshoesforshinsplints.info

    Daily visitors: –
    Keywords: best running shoes for shin splints, good running shoes for shin splints, mizuno creation 12 versus asics nimbus 13, wr850st, best shoes for lots and lots of walking
    bestmattressforsidesleepers.info – bestmattressforsidesleepers.info

    Daily visitors: –
    Keywords: best mattress for side sleepers, side sleepers mattress, z by malouf gelled microfiber, medi comfort mattresses, queen natura ultimate pillow, lifekind mattress review, talatech latex

  7. THEReporter says:

    2011-01-15
    Срок действия:2012-01-15
    Владелец: Aussawin Kampoosan Registrant Organization:
    Хостинговая компания: SoftLayer Technologies Inc.
    Регистратор:Afilias Global Registry Services
    IP адреса: 50.22.87.155
    DNS: ns2721.hostgator.com
    ns2722.hostgator.com

  8. THEReporter says:

    Address lookup
    canonical name usdloan.com.
    aliases
    addresses 216.172.187.63
    Domain Whois record

    Queried whois.internic.net with “dom usdloan.com”…

    Domain Name: USDLOAN.COM
    Registrar: GODADDY.COM, LLC
    Whois Server: whois.godaddy.com
    Referral URL: http://registrar.godaddy.com
    Name Server: NS1523.WEBSITEWELCOME.COM
    Name Server: NS1524.WEBSITEWELCOME.COM
    Status: clientDeleteProhibited
    Status: clientRenewProhibited
    Status: clientTransferProhibited
    Status: clientUpdateProhibited
    Updated Date: 07-may-2012
    Creation Date: 13-oct-2011
    Expiration Date: 13-oct-2012

    >>> Last update of whois database: Wed, 15 Aug 2012 04:29:48 UTC <<<

    Queried whois.godaddy.com with "usdloan.com"…

    Registrant:
    Aussawin Kampoosan

    Khon Kaen, SAKON NAKHON 40000
    Thailand

    Registered through: GoDaddy.com, LLC (http://www.godaddy.com)
    Domain Name: USDLOAN.COM
    Created on: 13-Oct-11
    Expires on: 13-Oct-12
    Last Updated on: 13-Oct-11

    Administrative Contact:
    Kampoosan, Aussawin winning.noom@gmail.com

    Khon Kaen, SAKON NAKHON 40000
    Thailand
    +66.846032471

    Technical Contact:
    Kampoosan, Aussawin winning.noom@gmail.com

    Khon Kaen, SAKON NAKHON 40000
    Thailand
    +66.846032471

    Domain servers in listed order:
    NS1523.WEBSITEWELCOME.COM
    NS1524.WEBSITEWELCOME.COM

    Network Whois record

    Queried rwhois.websitewelcome.com with "216.172.187.63"…

    %rwhois V-1.5:003eff:00 rwhois.websitewelcome.com (by Network Solutions, Inc. V-1.5.9.5)
    network:Class-Name:network
    network:ID:NETBLK-BO.216.172.187.63/32
    network:Auth-Area:216.172.187.63/32
    network:Network-Name:BO-216.172.187.63/32
    network:IP-Network:216.172.187.63/32
    network:IP-Network-Block:216.172.187.63 – 216.172.187.63
    network:Organization;I:autofinancingwestmichigan.com
    network:Tech-Contact;I:support@websitewelcome.com
    network:Admin-Contact;I:support@websitewelcome.com
    network:Created:20111226
    network:Updated:20120410
    network:Updated-By:support@websitewelcome.com

    network:Class-Name:network
    network:ID:NETBLK-BO.216.172.160.0/19
    network:Auth-Area:216.172.160.0/19
    network:Network-Name:BO-216.172.160.0/19
    network:IP-Network:216.172.160.0/19
    network:IP-Network-Block:216.172.160.0 – 216.172.191.255
    network:Organization;I:WEBSITEWELCOME.COM
    network:Tech-Contact;I:support@websitewelcome.com
    network:Admin-Contact;I:support@websitewelcome.com
    network:Created:20110729
    network:Updated:20110729
    network:Updated-By:support@websitewelcome.com

    %referral rwhois://root.rwhois.net:4321/auth-area=.
    %ok

    Queried whois.arin.net with "n 216.172.187.63"…

    NetRange: 216.172.160.0 – 216.172.191.255
    CIDR: 216.172.160.0/19
    OriginAS:
    NetName: HGBLOCK-2
    NetHandle: NET-216-172-160-0-1
    Parent: NET-216-0-0-0-0
    NetType: Direct Allocation
    RegDate: 2011-06-28
    Updated: 2012-03-02
    Ref: http://whois.arin.net/rest/net/NET-216-172-160-0-1

    OrgName: WEBSITEWELCOME.COM
    OrgId: BO
    Address: 11251 Northwest Freeway
    City: Houston
    StateProv: TX
    PostalCode: 77092
    Country: US
    RegDate: 2011-02-16
    Updated: 2012-07-20
    Ref: http://whois.arin.net/rest/org/BO

    ReferralServer: rwhois://rwhois.websitewelcome.com:4321

    OrgTechHandle: IPADM551-ARIN
    OrgTechName: IP Admin
    OrgTechPhone: +1-866-964-2867
    OrgTechEmail: ipadmin@websitewelcome.com
    OrgTechRef: http://whois.arin.net/rest/poc/IPADM551-ARIN

    OrgNOCHandle: IPADM551-ARIN
    OrgNOCName: IP Admin
    OrgNOCPhone: +1-866-964-2867
    OrgNOCEmail: ipadmin@websitewelcome.com
    OrgNOCRef: http://whois.arin.net/rest/poc/IPADM551-ARIN

    OrgAbuseHandle: IPADM551-ARIN
    OrgAbuseName: IP Admin
    OrgAbusePhone: +1-866-964-2867
    OrgAbuseEmail: ipadmin@websitewelcome.com
    OrgAbuseRef: http://whois.arin.net/rest/poc/IPADM551-ARIN

    RNOCHandle: IPADM551-ARIN
    RNOCName: IP Admin
    RNOCPhone: +1-866-964-2867
    RNOCEmail: ipadmin@websitewelcome.com
    RNOCRef: http://whois.arin.net/rest/poc/IPADM551-ARIN

    RTechHandle: IPADM551-ARIN
    RTechName: IP Admin
    RTechPhone: +1-866-964-2867
    RTechEmail: ipadmin@websitewelcome.com
    RTechRef: http://whois.arin.net/rest/poc/IPADM551-ARIN

    RAbuseHandle: IPADM551-ARIN
    RAbuseName: IP Admin
    RAbusePhone: +1-866-964-2867
    RAbuseEmail: ipadmin@websitewelcome.com
    RAbuseRef: http://whois.arin.net/rest/poc/IPADM551-ARIN

    DNS records

    DNS query for 63.187.172.216.in-addr.arpa returned an error from the server: NameError
    name class type data time to live
    usdloan.com IN TXT v=spf1 ip4:184.173.239.120 a mx include:websitewelcome.com ~all 14400s (04:00:00)
    usdloan.com IN MX
    preference: 0
    exchange: usdloan.com
    14400s (04:00:00)
    usdloan.com IN SOA
    server: ns1523.websitewelcome.com
    email: winning@noom.gmail.com
    serial: 2012050800
    refresh: 86400
    retry: 7200
    expire: 3600000
    minimum ttl: 86400
    86400s (1.00:00:00)
    usdloan.com IN NS ns1523.websitewelcome.com 86400s (1.00:00:00)
    usdloan.com IN NS ns1524.websitewelcome.com 86400s (1.00:00:00)
    usdloan.com IN A 216.172.187.63 14400s (04:00:00)

    — end —

  9. THEReporter says:

    173.0.56.148 – Other domains associated with this outfit

    Firstbankofdelawarepaydayloans.us
    nofaxpaydayloansx.us
    zip19cash.us
    30daypaydayloansx.us
    fasteasypaydayloansx.us
    Paydayloanshawaii.us
    cashadvancedirectlenders.us
    militarypaydays2011.us
    paydayloanscharlottenc.us
    Hardmoneylendersarizona.us
    noteletrackpaydayloanus.us
    consolidatepaydayloandebt.us
    noteletrackpaydayloansus.us
    fastcashpaydayloansx.us
    4cheapsale.com
    noteletrackloansz.us
    refundanticipationloans1.us
    unsecuredpersonallineofcredit.us
    paydayloanstoresz.us
    Chainwrapnecklacebright.info
    iamfed.com
    homesafetytoday.net
    furnacerepairinbaltimore.com
    giganticnetstores.info

  10. THEReporter says:

    IP Address: 50.22.87.155
    IP Location: US United States – Texas – Dallas – SOFTLAYER TECHNOLOGIES INC

    2makemoney.biz visit site
    kneeboardsforsale.info
    yo-world9821.info
    cheapsnowmobilehelmets.info
    halodrolreviews1.info
    cheapellipticalsforsale.com
    myfreesite30.com
    chinchillacagesforsale.info
    writeofpassion.com
    mia-links.com
    redtubesexy.com
    cheapkegerators.info
    arthousestore.net
    the-seafrontmeyer.com
    nerdbitchdramafag.com
    increaseprogress.com
    cheapsnowboardinggoggles.info
    cheapclarinets.info
    healthdietsupplements.net
    novaformmattressreview.info
    onlinebusinessclubhouse.com
    u-buysmart.com
    cloverclutz.com
    infipedia.net
    portapottyprices.info
    e-booksclickstore.com
    halfpipesforsale.info
    idylisairpurifierreview.info
    portablerestroomsforsale.info
    electricimpactwrenchreviews.info
    croquetsetsforsale.info
    snakecagesforsale.info
    zeroturnmowerscomparison.info
    cheapwakeboards.info
    residualrx.com
    slidingcompoundmitersaws.info
    poterefemminile.com
    godisjesuschrist.com
    howdoyoureducebodyfat.com
    automotivedoctors.com

Leave A Comment

Fill in your details below or click an icon to log in:

WordPress.com Logo

You are commenting using your WordPress.com account. Log Out /  Change )

Google+ photo

You are commenting using your Google+ account. Log Out /  Change )

Twitter picture

You are commenting using your Twitter account. Log Out /  Change )

Facebook photo

You are commenting using your Facebook account. Log Out /  Change )

Connecting to %s

This site uses Akismet to reduce spam. Learn how your comment data is processed.